Forum

Nome Utente:
Password:
Riconoscimi automaticamente
 Tutti i Forum
 Laboratorio
 Bioinformatica e Biostatistica
 Prosite aiuto!!!
 Nuova Discussione  Nuovo Sondaggio Nuovo Sondaggio
 Rispondi Aggiungi ai Preferiti Aggiungi ai Preferiti
Cerca nelle discussioni
I seguenti utenti stanno leggendo questo Forum Qui c'č:

Aggiungi Tag Aggiungi i tag

Quanto č utile/interessante questa discussione:

Autore Discussione  

steffi85
Nuovo Arrivato


Prov.: Mantova
Cittą: castiglione delle stiviere


25 Messaggi

Inserito il - 22 novembre 2010 : 11:40:07  Mostra Profilo  Visita l'Homepage di steffi85 Invia a steffi85 un Messaggio Privato  Rispondi Quotando
ciao a tutti!

Allora... mi sto cimentando con prosite.

la mia sequenza in fasta format č:
>sp|Q00511|URIC_ASPFL Uricase OS=Aspergillus flavus GN=uaZ PE=1 SV=3
MSAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDS
IKNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHS
FIRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILS
TDVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQIL
ARQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKS
KL

la profe mi kiede:
1) qunti matches significativi avete trovato?
2)che informazioni vi danno?
3) quanti rules avete trovato?

se lancio scanprosite ottengo:


hits by patterns: [1 hit (by 1 pattern) on 1 sequence]

Hits by PS00366   URICASE   Uricase signature :
sp-Q00511-URI~

    (302 aa)

150 - 177:
  LtVLKSTnSqFwgFlrdeYttLketwdR

I matches significativi sono quelli dal 150 al 177? e questi costituiscono un unico pattern, dato che il patern č un motivo definito con una sintassi riconducibile ad un'espressione regolare?
Infine... i rules so che sono meno stringenti dei pattern, lunghi 3/4 residui e possono corrispondere a siti in cui avvengono modificazioni post-traduzionali; ma come li trovo in questo caso?

Grazie mille a tutti!

dallolio_gm
Moderatore


Prov.: Bo!
Cittą: Barcelona/Bologna


2445 Messaggi

Inserito il - 02 dicembre 2010 : 18:27:37  Mostra Profilo  Visita l'Homepage di dallolio_gm  Clicca per vedere l'indirizzo MSN di dallolio_gm Invia a dallolio_gm un Messaggio Privato  Rispondi Quotando
ciao, scusa il ritardo nel scrivere!!

penso che nella tua sequenza non ci sia nessuna corrisponza con alcun rule.

Per controllare, puoi cercare una sequenza in cui č sicuro che vi sia un match con un rule (le trovi nelle descrizioni dei singoli rule).

Il mio blog di bioinformatics (inglese): BioinfoBlog
Sono un po' lento a rispondere, posso tardare anche qualche giorno... ma abbiate fede! :-)
Torna all'inizio della Pagina

steffi85
Nuovo Arrivato


Prov.: Mantova
Cittą: castiglione delle stiviere


25 Messaggi

Inserito il - 03 dicembre 2010 : 16:05:25  Mostra Profilo  Visita l'Homepage di steffi85 Invia a steffi85 un Messaggio Privato  Rispondi Quotando
ok, ma...
la descrizione dei rule dove resta? nella pagina ho cliccato ovunque, ma no trovo nulla!!!! help....
Torna all'inizio della Pagina
  Discussione  

Quanto č utile/interessante questa discussione:

 Nuova Discussione  Nuovo Sondaggio Nuovo Sondaggio
 Rispondi Aggiungi ai Preferiti Aggiungi ai Preferiti
Cerca nelle discussioni
Vai a:
MolecularLab.it © 2003-18 MolecularLab.it Torna all'inizio della Pagina