Forum

Nome Utente:
Password:
Riconoscimi automaticamente
Password Dimenticata?

 Tutti i Forum
 Laboratorio
 Bioinformatica e Biostatistica
 Sequenza nucleotidica
 Nuova Discussione  Nuovo Sondaggio Nuovo Sondaggio
 Rispondi Aggiungi ai Preferiti Aggiungi ai Preferiti
Cerca nelle discussioni
I seguenti utenti stanno leggendo questo Forum Qui c'è:

Aggiungi Tag Aggiungi i tag

Quanto è utile/interessante questa discussione:

Autore Discussione  

Remcast
Nuovo Arrivato



3 Messaggi

Inserito il - 15 dicembre 2017 : 12:11:42  Mostra Profilo Invia a Remcast un Messaggio Privato  Rispondi Quotando
Ciao a tutti ragazzi, non riesco proprio a capire come convertire la mia sequenza FASTA in sequenza nucleotidica. So che devo usare tblastn ma poi da lì? Qualcuno potrebbe spiegarmelo passo passo?
La mia sequenza FASTA è la seguente:
>2RTD:B|PDBID|CHAIN|SEQUENCE
DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK
NNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP
>2RTD:D|PDBID|CHAIN|SEQUENCE
DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWK
NNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP

domi84
Moderatore

Smile3D

Città: Glasgow


1547 Messaggi

Inserito il - 16 dicembre 2017 : 00:11:51  Mostra Profilo  Visita l'Homepage di domi84 Invia a domi84 un Messaggio Privato  Rispondi Quotando
tblastn converte la sequenza in dna E la cerca in un database. Se vuoi solo convertire puoi usare:
https://www.ebi.ac.uk/Tools/st/

Il mio blog: http://domi84.blogspot.com/
Le foto che ho scattato...
Torna all'inizio della Pagina
  Discussione  

Quanto è utile/interessante questa discussione:

 Nuova Discussione  Nuovo Sondaggio Nuovo Sondaggio
 Rispondi Aggiungi ai Preferiti Aggiungi ai Preferiti
Cerca nelle discussioni
Vai a:
MolecularLab.it © 2003-14 MolecularLab.it Torna all'inizio della Pagina